interleukina 1 beta

Beta-Amyloid (1-11)

A1002-1 1 mg
EUR 102
Description: Beta-amyloid (1-11) (Abeta or A?) (C56H76N16O22) is a peptide with the sequence H-{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}-OH,which is processed from the Amyloid precursor protein.

IL-1-beta Interleukin-1 beta Mouse Recombinant Protein, His Tag

PROTP10749-1 Regular: 25ug
EUR 317
Description: Interleukin-1 beta Mouse Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 189 amino acids and having a molecular mass of 21 kDa. ;The IL-1b is fused to His-Tag and purified by proprietary chromatographic techniques.

IL-1 beta, rat recombinant

P1019-1 1 mg
EUR 7288
Description: Interleukin 1 beta (IL-1?) is a proinflammatory cytokine and is produced by activated macrophages, monocytes, keratinocytes and other epithelial cells. Both IL-1? and IL-1? bind to the same receptor and have similar biological properties.

ER beta-1 (Estrogen Receptor beta-1); Clone ERb455 (Concentrate)

RA0111-C.1 0.1 ml
EUR 125

IL-1-beta Interleukin-1 betaHuman Recombinant Protein

PROTP01584-1 Regular: 10ug
EUR 317
Description: Interleukin-1 beta Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17000 Dalton.;The IL-1b is purified by proprietary chromatographic techniques.

Recombinant Human Heregulin Beta -1 Protein

PROTQ02297-1 50ug
EUR 317
Description: Neuregulin/Heregulin is a family of structurally related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms release soluble growth factors. HRG1-β1 contains an Ig domain and an EGF-like domain that is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. Although HRG1-β1 biological effects is still unclear, it has been found to promote motility and invasiveness of breast cancer cells which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF). Recombinant human Heregulin-β1 (HRG1-β1) is a 7.5 kDa polypeptide consisting of only the EGF domain of Heregulin-β1 (65 amino acid residues).

Recombinant Rat IL-1 Beta Protein

PROTQ63264-1 10ug
EUR 317
Description: IL-1β is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1α and IL-1β binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1β is a secreted cytokine, IL-1α is predominantly a cell-associated cytokine. Recombinant rat IL-1β is a 17.4 kDa protein containing 153 amino acid residues.

Canine IL-1 beta Recombinant Protein

R00101-1 5ug/vial
EUR 259
Description: IL-1 beta (IL-1β) is a member of the interleukin 1 family of cytokines. The IL-1 beta cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. Canine IL-1 beta Recombinant Protein is purified interleukin-1 beta cytokine produced in yeast.

Equine IFN beta 1 Recombinant Protein

R02041-1 5ug/vial
EUR 259
Description: IFN beta is a mammalian Type I inferferon, functionig as a regulator of cellular activity by interacting with cell-surface receptors and activating various signaling pathways. IFN beta produces antiviral, antibacterial, and anticancer properties. Equine IFN beta Recombinant Protein is purified IFN beta produced in yeast.

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Human TGF-beta-1 AssayMax ELISA Kit

ET3102-1 96 Well Plate
EUR 477

Recombinant Rat MIP-1 Beta (CCL4) Protein

PROTP50230-1 20ug
EUR 317
Description: Both MIP-1α and MIP-1β are structurally and functionally related CC chemokines. They participate in the host response to invading bacterial, viral, parasite and fungal pathogens by regulating the trafficking and activation state of selected subgroups of inflammatory cells e.g. macrophages, lymphocytes and NK cells. While both MIP-1α and MIP-1β exert similar effects on monocytes their effect on lymphocytes differ; with MIP-1α selectively attracting CD8+ lymphocytes and MIP-1β selectively attracting CD4+ lymphocytes. Additionally, MIP-1α and MIP-1β have also been shown to be potent chemoattractants for B cells, eosinophils and dendritic cells. Both human and murine MIP-1α and MIP-1β are active on human and murine hematopoietic cells. Recombinant rat MIP-1β is a 7.8 kDa protein containing 69 amino acid residues, including the four highly conserved cysteine residues present in CC chemokines.

Anti-Integrin beta 1 Rabbit Monoclonal Antibody

M00772-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal Integrin beta 1 Antibody. Validated in IHC, WB and tested in Human, Mouse, Rat.

Recombinant Murine MIP-1 Beta (CCL4) Protein

PROTP14097-1 10ug
EUR 317
Description: Both MIP-1α and MIP-1β are structurally and functionally related CC chemokines. They participate in the host response to invading bacterial, viral, parasite and fungal pathogens by regulating the trafficking and activation state of selected subgroups of inflammatory cells e.g. macrophages, lymphocytes and NK cells. While both MIP-1α and MIP-1β exert similar effects on monocytes their effect on lymphocytes differ; with MIP-1α selectively attracting CD8+ lymphocytes and MIP-1β selectively attracting CD4+ lymphocytes. Additionally, MIP-1α and MIP-1β have also been shown to be potent chemoattractants for B cells, eosinophils and dendritic cells. Both human and murine MIP-1α and MIP-1β are active on human and murine hematopoietic cells. Recombinant murine MIP-1β is a 7.8 kDa protein containing 69 amino acid residues, including the four highly conserved cysteine residues present in CC chemokines.

TGF-b-1 Transforming Growth Factor-beta 1 Human protein

PROTP01137-1 Regular: 2.5ug
EUR 1157
Description: Human Transforming Growth Factor-beta 1 purified from Human Platelets having a molecular mass of 25kDa.;The TGF-b 1 is purified by proprietary chromatographic techniques.

ITGB1 Human, Integrin Beta 1 Human Recombinant Protein, Sf9

PROTP05556-1 Regular: 10ug
EUR 317
Description: ITGB1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 716 amino acids (1-728) and having a molecular mass of 79.4kDa (Molecular size on SDS-PAGE will appear at approximately 70-100kDa). ITGB1 is fused to an 8 amino acid His-Tag at C-terminus and purified by proprietary chromatographic techniques. 

PSG1 Human, Pregnancy Specific Beta-1-Glycoprotein 1 Human Recombinant Protein, Sf9

PROTP11464-1 Regular: 10ug
EUR 317
Description: PSG1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 394 amino acids (35-419a.a.) and having a molecular mass of 44.6kDa (Molecular size on SDS-PAGE will appear at approximately 40-57kDa). PSG1 is expressed with a 6 amino acids His tag at C-Terminus and purified by proprietary chromatographic techniques.

TPSAB1 Human, Tryptase Alpha/Beta 1 Human Recombinant Protein, Sf9

PROTQ15661-1 Regular: 10ug
EUR 317
Description: TPSAB1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain (31-275 a.a.) and fused to a 6 aa His Tag at C-terminus containing a total of 251 amino acids and having a molecular mass of 28.2kDa.TPSAB1 shows multiple bands between 28-40kDa on SDS-PAGE, reducing conditions and purified by proprietary chromatographic techniques. 

ATP1B1 Human, ATPase Transporting Beta 1 Human Recombinant Protein, Sf9

PROTP05026-1 Regular: 10ug
EUR 317
Description: ATP1B1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 250 amino acids (63-303 a.a.) and having a molecular mass of 29kDa (Molecular size on SDS-PAGE will appear at approximately 28-40 kDa).;ATP1B1 is expressed with a 6 amino acid His tag at C-Terminus and purified by proprietary chromatographic techniques.

ATP1B2 Human, ATPase Transporting Beta 1 Human Recombinant Protein, Sf9

PROTP14415-1 Regular: 10ug
EUR 317
Description: ATP1B2 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 232 amino acids (68-290a.a.) and having a molecular mass of 26.4kDa (Molecular size on SDS-PAGE will appear at approximately 28-40 kDa). ATP1B2 is expressed with a 9 amino acid His tag at C-Terminus and purified by proprietary chromatographic techniques.

Beta-Secretase Inhibitor I

EUR 262

Beta-Secretase Inhibitor II

EUR 164

Anti-DGK- beta Antibody

A07973-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for DGK- beta Antibody (DGKB) detection. Tested with WB in Human, Mouse, Rat.

IL12RB1 Human, Interleukin 12 Receptor Beta 1 Human Recombinant Protein, Sf9

PROTP42701-1 Regular: 10ug
EUR 317
Description: IL12RB1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain (24-545 a.a.) and fused to a 6 aa His Tag at C-terminus containing a total of 528 amino acids and having a molecular mass of 58.4kDa.;IL12RB1 shows multiple bands between 50-70kDa on SDS-PAGE, reducing conditions and purified by proprietary chromatographic techniques.

PSG5 Human, Pregnancy Specific Beta-1-Glycoprotein 5 Human Recombinant Protein, Sf9

PROTQ15238-1 Regular: 5ug
EUR 317
Description: PSG5 Human Recombinant produced in Sf9 Insect cells is a single, glycosylated polypeptide chain containing 310 amino acids (35-335 a.a.) and having a molecular mass of 35.1kDa (Molecular size on SDS-PAGE will appear at approximately 28-40kDa). PSG5 is expressed with a 6 amino acids His tag at C-Terminus and purified by proprietary chromatographic techniques. 

HSP90B1 Heat Shock Protein 90kDa Beta (GRP94) Member 1 Human Recombinant Protein

PROTP14625-1 Regular: 10ug
EUR 317
Description: HSP90B1 produced in E.Coli is a single, non-glycosylated polypeptide chain containing 819 amino acids (22-803 a.a.) and having a molecular mass of 94.4 kDa.;HSP90B1 is expressed with a 36 amino acid His tag at N-Terminus and purified by proprietary chromatographic techniques.

ST6GAL1Human, ST6 Beta-Galactosamide Alpha-2,6-Sialyltranferase 1, sf9 Human Recombinant Protein

PROTP15907-1 Regular: 10ug
EUR 317
Description: ST6GAL1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 389 amino acids (27-406 a.a.) and having a molecular mass of 44.6kDa (Migrates at 40-57kDa on SDS-PAGE under reducing conditions).

Anti-IL1 beta/Il1b Antibody

A00101-1 100ug/vial
EUR 294

Anti-Beta Tubulin/TUBB Antibody

A01857-1 100ug/vial
EUR 334

Anti-DNA pol beta Antibody

A01946-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for DNA pol beta Antibody (POLB) detection.tested for WB in Human, Mouse, Rat.

Anti-PP1 beta Monoclonal Antibody

A04022-1 100ul
EUR 397
Description: Mouse Monoclonal Antibody for PP1 beta Antibody (PPP1CB) detection. Tested with WB in Human, Mouse, Rat, Chicken, Dog, Pig.

Anti-PP2A-A beta Antibody

A05756-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for PP2A-A beta Antibody (PPP2R1B) detection.tested for WB in Human, Mouse, Rat.

Anti-G beta 5 Antibody

A06754-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for G beta 5 Antibody (GNB5) detection.tested for WB in Human, Mouse, Rat.

Anti-IL-3R beta Antibody

A02219-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for IL-3R beta Antibody (CSF2RB) detection.tested for WB in Human, Mouse, Rat.

Anti-beta glucuronidase/GUSB Antibody

A02234-1 100ug/vial
EUR 294

Anti-PGC1 beta/PPARGC1B Antibody

A02933-1 100ug/vial
EUR 294

Anti-Inhibin beta-C Antibody

A10556-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Inhibin beta-C Antibody (INHBC) detection. Tested with WB in Human, Mouse, Rat.

Recombinant Murine RELM Beta Protein

PROTQ99P86-1 25ug
EUR 317
Description: RELMβ (Resistin-like molecule β/FIZZ2) is an 18 kDa disulfide-linked homodimeric protein expressed in the epithelium of the colon and small bowel. The biological functions of RELMβ, and its molecular targets, are not fully known but, it has been suggested that it plays a regulatory role during inflammation and may also act to establish links among adipose tissue, the intestine and the liver (Rajala, M. et al. J. Clin. Invest. Vol. 111, 225-230 (2003)). Interestingly the molecular structure of RELMβ is highly homologous to that of the adipose-derived cytokine Resistin and RELMβ. These proteins share a highly conserved C-terminal domain, characterized by 10 cysteine residues with a unique spacing motif of C-X11-C-X8-C-X-C-X3-C-X10-C-X-C-X-C-X9-C-C. Recombinant Murine RELMβ is an 18.0 kDa, consisting of two 83 amino acid residue chains.

RELM-Beta Human Recombinant Protein

PROTQ9BQ08-1 Regular: 25ug
EUR 317
Description: RELM-b Human Recombinant produced in E.Coli is a disulfide-linked homodimer, non-glycosylated, polypeptide chain containing 2 x 89 amino acids and having a total molecular mass of 19kDa. ;RELM-b is purified by proprietary chromatographic techniques.

Recombinant Human SCGF-Beta Protein

PROTQ9Y240-1 10ug
EUR 317
Description: SCGF-α and -β are hematopoietic growth factor that exerts their activity at early stages of hematopoiesis. The SCGFs are non-glycosylated species-specific cytokines that can support growth of primitive hematopoietic cells, and in combination with EPO or GM-CSF, promote proliferation or erthroid or myeloid progenitors, respectively. Recombinant human SCGF-β is a 25.0 kDa polypeptide containing 227 amino acid residues.

Anti-beta Catenin/CTNNB1 Antibody

PA1212-1 100ug/vial
EUR 334

Anti-TNF beta/LTA Antibody

PA1361-1 100ug/vial
EUR 294

Anti-IKK beta/IKBKB Antibody

PA2036-1 100ug/vial
EUR 294

Anti-PDGF Receptor beta/PDGFRB Antibody

A00096-1 100ug/vial
EUR 334

Anti-Beta 2 Microglobulin/B2M Antibody

A00456-1 100ug/vial
EUR 334

Anti-Estrogen Receptor beta/ESR2 Antibody

A00786-1 100ug/vial
EUR 294

Anti-TGF beta 2/TGFB2 Antibody

A00892-1 100ug/vial
EUR 334

Anti-Fibrinogen beta chain/FGB Antibody

A01204-1 100ug/vial
EUR 294

Anti- beta II tubulin Monoclonal Antibody

A06868-1 100ul
EUR 397
Description: Mouse Monoclonal Antibody for beta II tubulin Antibody (TUBB2A) detection.tested for IHC, IP, WB in Mouse, Rat.

B2M Beta-2 Microglobulin Human protein

PROTP61769-1 Regular: 1mg
EUR 317
Description: Human Beta-2 Microglobulin produced in Human urine from patients with tubular proteinuria having a molecular mass of 12KDa and pI of 5.6.

Recombinant Human Thymosin-Beta 4 Protein

PROTP62328-1 100ug
EUR 317
Description: Thymosin-β4 is a small, actin-sequestering protein belonging to the thymosin-β family that is found at high concentrations within the spleen, thymus, and peritoneal macrophages, where it is most notably responsible for the organization of cytoskeletal structure. In mammalian tissues, this protein acts as a modulator for the polymerization/depolymerization of actin through the formation of a 1:1 complex with the monomer G (globular)-actin, and inhibits actin’s polymerization to form F (filamentous) actin, which together with other proteins binds microfilaments to construct the cytoskeleton. Commonly found at significant quantities within the brain, lungs, liver, kidneys, testes, and heart, Thymosin-β4 has also been shown to be synthesized by cells unrelated to the reticuloendothelial system, such as myoblasts and fibroblasts, and expressed at irregular levels by several hemopoietic cell lines, malignant lymphoid cells and myeloma cells. In addition to regulating actin polymerization, research has also found Thymosin-β4 to stimulate the secretion of hypothalamic luteinizing hormone-releasing hormone and luteinizing hormone, inhibit the migration of peritoneal macrophages, induce phenotypic changes in T cell lines during early host defense mechanisms, and inhibit the progression of hematopoietic pluripotent stem cells into the s-phase. Recombinant Human Thymosin-β4 is a 5.2 kDa glycoprotein containing 45 amino acid residues.

Anti-beta Catenin Rabbit Monoclonal Antibody

M00004-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal beta Catenin Antibody. Validated in IP, IF, IHC, ICC, WB and tested in Human, Mouse, Rat.

Anti-IL1 beta Rabbit Monoclonal Antibody

M00101-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal IL1 beta Antibody. Validated in WB and tested in Human.

Anti-IKK beta Rabbit Monoclonal Antibody

M00118-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal IKK beta Antibody. Validated in IP, WB and tested in Human, Mouse.

Anti-CEBP Beta Rabbit Monoclonal Antibody

M01100-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal CEBP Beta Antibody. Validated in IP, WB and tested in Human, Mouse, Rat.

Anti-Hsp90 beta Rabbit Monoclonal Antibody

M01692-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal Hsp90 beta Antibody. Validated in IP, IF, IHC, WB and tested in Human, Mouse, Rat.

Anti-FSH beta (FSHB) Monoclonal Antibody

M01885-1 100ug
EUR 397
Description: Rabbit Monoclonal FSH beta (FSHB) Antibody. Validated in IP, WB and tested in Human.

LD78-beta (CCL3L1) Human Recombinant Protein

PROTP16619-1 Regular: 20ug
EUR 317
Description: CCL3L1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 70 amino acids and having a molecular mass of 7.7kDa. The CCL3L1 is purified by proprietary chromatographic techniques.

Anti-Integrin beta 4/ITGB4 Antibody

PA1702-1 100ug/vial
EUR 294

Amyloid Beta-peptide (25-35) (human)

A1039-1 1 mg
EUR 115
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42).

Back to top