Beta-Amyloid (1-11) |
|||
| A1002-1 | ApexBio | 1 mg | EUR 102 |
|
Description: Beta-amyloid (1-11) (Abeta or A?) (C56H76N16O22) is a peptide with the sequence H-{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}-OH,which is processed from the Amyloid precursor protein. |
|||
IL-1-beta Interleukin-1 beta Mouse Recombinant Protein, His Tag |
|||
| PROTP10749-1 | BosterBio | Regular: 25ug | EUR 317 |
|
Description: Interleukin-1 beta Mouse Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 189 amino acids and having a molecular mass of 21 kDa. ;The IL-1b is fused to His-Tag and purified by proprietary chromatographic techniques. |
|||
IL-1 beta, rat recombinant |
|||
| P1019-1 | ApexBio | 1 mg | EUR 7288 |
|
Description: Interleukin 1 beta (IL-1?) is a proinflammatory cytokine and is produced by activated macrophages, monocytes, keratinocytes and other epithelial cells. Both IL-1? and IL-1? bind to the same receptor and have similar biological properties. |
|||
ER beta-1 (Estrogen Receptor beta-1); Clone ERb455 (Concentrate) |
|||
| RA0111-C.1 | ScyTek Laboratories | 0.1 ml | EUR 125 |
IL-1-beta Interleukin-1 betaHuman Recombinant Protein |
|||
| PROTP01584-1 | BosterBio | Regular: 10ug | EUR 317 |
|
Description: Interleukin-1 beta Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17000 Dalton.;The IL-1b is purified by proprietary chromatographic techniques. |
|||
Recombinant Human Heregulin Beta -1 Protein |
|||
| PROTQ02297-1 | BosterBio | 50ug | EUR 317 |
|
Description: Neuregulin/Heregulin is a family of structurally related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms release soluble growth factors. HRG1-β1 contains an Ig domain and an EGF-like domain that is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. Although HRG1-β1 biological effects is still unclear, it has been found to promote motility and invasiveness of breast cancer cells which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF). Recombinant human Heregulin-β1 (HRG1-β1) is a 7.5 kDa polypeptide consisting of only the EGF domain of Heregulin-β1 (65 amino acid residues). |
|||
Recombinant Rat IL-1 Beta Protein |
|||
| PROTQ63264-1 | BosterBio | 10ug | EUR 317 |
|
Description: IL-1β is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1α and IL-1β binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1β is a secreted cytokine, IL-1α is predominantly a cell-associated cytokine. Recombinant rat IL-1β is a 17.4 kDa protein containing 153 amino acid residues. |
|||
Canine IL-1 beta Recombinant Protein |
|||
| R00101-1 | BosterBio | 5ug/vial | EUR 259 |
|
Description: IL-1 beta (IL-1β) is a member of the interleukin 1 family of cytokines. The IL-1 beta cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. Canine IL-1 beta Recombinant Protein is purified interleukin-1 beta cytokine produced in yeast. |
|||
Equine IFN beta 1 Recombinant Protein |
|||
| R02041-1 | BosterBio | 5ug/vial | EUR 259 |
|
Description: IFN beta is a mammalian Type I inferferon, functionig as a regulator of cellular activity by interacting with cell-surface receptors and activating various signaling pathways. IFN beta produces antiviral, antibacterial, and anticancer properties. Equine IFN beta Recombinant Protein is purified IFN beta produced in yeast. |
|||
Amyloid Beta-Peptide (1-40) (human) |
|||
| A1124-1 | ApexBio | 1 mg | EUR 189 |
|
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
|||
Recombinant Rat MIP-1 Beta (CCL4) Protein |
|||
| PROTP50230-1 | BosterBio | 20ug | EUR 317 |
|
Description: Both MIP-1α and MIP-1β are structurally and functionally related CC chemokines. They participate in the host response to invading bacterial, viral, parasite and fungal pathogens by regulating the trafficking and activation state of selected subgroups of inflammatory cells e.g. macrophages, lymphocytes and NK cells. While both MIP-1α and MIP-1β exert similar effects on monocytes their effect on lymphocytes differ; with MIP-1α selectively attracting CD8+ lymphocytes and MIP-1β selectively attracting CD4+ lymphocytes. Additionally, MIP-1α and MIP-1β have also been shown to be potent chemoattractants for B cells, eosinophils and dendritic cells. Both human and murine MIP-1α and MIP-1β are active on human and murine hematopoietic cells. Recombinant rat MIP-1β is a 7.8 kDa protein containing 69 amino acid residues, including the four highly conserved cysteine residues present in CC chemokines. |
|||
Anti-Integrin beta 1 Rabbit Monoclonal Antibody |
|||
| M00772-1 | BosterBio | 100ug/vial | EUR 397 |
|
Description: Rabbit Monoclonal Integrin beta 1 Antibody. Validated in IHC, WB and tested in Human, Mouse, Rat. |
|||
Recombinant Murine MIP-1 Beta (CCL4) Protein |
|||
| PROTP14097-1 | BosterBio | 10ug | EUR 317 |
|
Description: Both MIP-1α and MIP-1β are structurally and functionally related CC chemokines. They participate in the host response to invading bacterial, viral, parasite and fungal pathogens by regulating the trafficking and activation state of selected subgroups of inflammatory cells e.g. macrophages, lymphocytes and NK cells. While both MIP-1α and MIP-1β exert similar effects on monocytes their effect on lymphocytes differ; with MIP-1α selectively attracting CD8+ lymphocytes and MIP-1β selectively attracting CD4+ lymphocytes. Additionally, MIP-1α and MIP-1β have also been shown to be potent chemoattractants for B cells, eosinophils and dendritic cells. Both human and murine MIP-1α and MIP-1β are active on human and murine hematopoietic cells. Recombinant murine MIP-1β is a 7.8 kDa protein containing 69 amino acid residues, including the four highly conserved cysteine residues present in CC chemokines. |
|||
Human TGF-beta-1 AssayMax ELISA Kit |
|||
| ET3102-1 | AssayPro | 96 Well Plate | EUR 477 |
TGF-b-1 Transforming Growth Factor-beta 1 Human protein |
|||
| PROTP01137-1 | BosterBio | Regular: 2.5ug | EUR 1157 |
|
Description: Human Transforming Growth Factor-beta 1 purified from Human Platelets having a molecular mass of 25kDa.;The TGF-b 1 is purified by proprietary chromatographic techniques. |
|||
ITGB1 Human, Integrin Beta 1 Human Recombinant Protein, Sf9 |
|||
| PROTP05556-1 | BosterBio | Regular: 10ug | EUR 317 |
|
Description: ITGB1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 716 amino acids (1-728) and having a molecular mass of 79.4kDa (Molecular size on SDS-PAGE will appear at approximately 70-100kDa). ITGB1 is fused to an 8 amino acid His-Tag at C-terminus and purified by proprietary chromatographic techniques. |
|||
PSG1 Human, Pregnancy Specific Beta-1-Glycoprotein 1 Human Recombinant Protein, Sf9 |
|||
| PROTP11464-1 | BosterBio | Regular: 10ug | EUR 317 |
|
Description: PSG1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 394 amino acids (35-419a.a.) and having a molecular mass of 44.6kDa (Molecular size on SDS-PAGE will appear at approximately 40-57kDa). PSG1 is expressed with a 6 amino acids His tag at C-Terminus and purified by proprietary chromatographic techniques. |
|||
TPSAB1 Human, Tryptase Alpha/Beta 1 Human Recombinant Protein, Sf9 |
|||
| PROTQ15661-1 | BosterBio | Regular: 10ug | EUR 317 |
|
Description: TPSAB1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain (31-275 a.a.) and fused to a 6 aa His Tag at C-terminus containing a total of 251 amino acids and having a molecular mass of 28.2kDa.TPSAB1 shows multiple bands between 28-40kDa on SDS-PAGE, reducing conditions and purified by proprietary chromatographic techniques. |
|||
ATP1B1 Human, ATPase Transporting Beta 1 Human Recombinant Protein, Sf9 |
|||
| PROTP05026-1 | BosterBio | Regular: 10ug | EUR 317 |
|
Description: ATP1B1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 250 amino acids (63-303 a.a.) and having a molecular mass of 29kDa (Molecular size on SDS-PAGE will appear at approximately 28-40 kDa).;ATP1B1 is expressed with a 6 amino acid His tag at C-Terminus and purified by proprietary chromatographic techniques. |
|||
ATP1B2 Human, ATPase Transporting Beta 1 Human Recombinant Protein, Sf9 |
|||
| PROTP14415-1 | BosterBio | Regular: 10ug | EUR 317 |
|
Description: ATP1B2 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 232 amino acids (68-290a.a.) and having a molecular mass of 26.4kDa (Molecular size on SDS-PAGE will appear at approximately 28-40 kDa). ATP1B2 is expressed with a 9 amino acid His tag at C-Terminus and purified by proprietary chromatographic techniques. |
|||
Anti-DGK- beta Antibody |
|||
| A07973-1 | BosterBio | 100ul | EUR 397 |
|
Description: Rabbit Polyclonal Antibody for DGK- beta Antibody (DGKB) detection. Tested with WB in Human, Mouse, Rat. |
|||
Beta-Secretase Inhibitor I |
|||
| 7501-1 | Biovision | EUR 262 | |
Beta-Secretase Inhibitor II |
|||
| 7502-1 | Biovision | EUR 164 | |
IL12RB1 Human, Interleukin 12 Receptor Beta 1 Human Recombinant Protein, Sf9 |
|||
| PROTP42701-1 | BosterBio | Regular: 10ug | EUR 317 |
|
Description: IL12RB1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain (24-545 a.a.) and fused to a 6 aa His Tag at C-terminus containing a total of 528 amino acids and having a molecular mass of 58.4kDa.;IL12RB1 shows multiple bands between 50-70kDa on SDS-PAGE, reducing conditions and purified by proprietary chromatographic techniques. |
|||
Recombinant Murine RELM Beta Protein |
|||
| PROTQ99P86-1 | BosterBio | 25ug | EUR 317 |
|
Description: RELMβ (Resistin-like molecule β/FIZZ2) is an 18 kDa disulfide-linked homodimeric protein expressed in the epithelium of the colon and small bowel. The biological functions of RELMβ, and its molecular targets, are not fully known but, it has been suggested that it plays a regulatory role during inflammation and may also act to establish links among adipose tissue, the intestine and the liver (Rajala, M. et al. J. Clin. Invest. Vol. 111, 225-230 (2003)). Interestingly the molecular structure of RELMβ is highly homologous to that of the adipose-derived cytokine Resistin and RELMβ. These proteins share a highly conserved C-terminal domain, characterized by 10 cysteine residues with a unique spacing motif of C-X11-C-X8-C-X-C-X3-C-X10-C-X-C-X-C-X9-C-C. Recombinant Murine RELMβ is an 18.0 kDa, consisting of two 83 amino acid residue chains. |
|||
RELM-Beta Human Recombinant Protein |
|||
| PROTQ9BQ08-1 | BosterBio | Regular: 25ug | EUR 317 |
|
Description: RELM-b Human Recombinant produced in E.Coli is a disulfide-linked homodimer, non-glycosylated, polypeptide chain containing 2 x 89 amino acids and having a total molecular mass of 19kDa. ;RELM-b is purified by proprietary chromatographic techniques. |
|||
Recombinant Human SCGF-Beta Protein |
|||
| PROTQ9Y240-1 | BosterBio | 10ug | EUR 317 |
|
Description: SCGF-α and -β are hematopoietic growth factor that exerts their activity at early stages of hematopoiesis. The SCGFs are non-glycosylated species-specific cytokines that can support growth of primitive hematopoietic cells, and in combination with EPO or GM-CSF, promote proliferation or erthroid or myeloid progenitors, respectively. Recombinant human SCGF-β is a 25.0 kDa polypeptide containing 227 amino acid residues. |
|||
Anti-beta Catenin/CTNNB1 Antibody |
|||
| PA1212-1 | BosterBio | 100ug/vial | EUR 334 |
Anti-TNF beta/LTA Antibody |
|||
| PA1361-1 | BosterBio | 100ug/vial | EUR 294 |
Anti-IKK beta/IKBKB Antibody |
|||
| PA2036-1 | BosterBio | 100ug/vial | EUR 294 |
Anti-IL1 beta/Il1b Antibody |
|||
| A00101-1 | BosterBio | 100ug/vial | EUR 294 |
Anti-Beta Tubulin/TUBB Antibody |
|||
| A01857-1 | BosterBio | 100ug/vial | EUR 334 |
Anti-DNA pol beta Antibody |
|||
| A01946-1 | BosterBio | 100ul | EUR 397 |
|
Description: Rabbit Polyclonal Antibody for DNA pol beta Antibody (POLB) detection.tested for WB in Human, Mouse, Rat. |
|||
Anti-PP1 beta Monoclonal Antibody |
|||
| A04022-1 | BosterBio | 100ul | EUR 397 |
|
Description: Mouse Monoclonal Antibody for PP1 beta Antibody (PPP1CB) detection. Tested with WB in Human, Mouse, Rat, Chicken, Dog, Pig. |
|||
Anti-PP2A-A beta Antibody |
|||
| A05756-1 | BosterBio | 100ul | EUR 397 |
|
Description: Rabbit Polyclonal Antibody for PP2A-A beta Antibody (PPP2R1B) detection.tested for WB in Human, Mouse, Rat. |
|||
Anti-G beta 5 Antibody |
|||
| A06754-1 | BosterBio | 100ul | EUR 397 |
|
Description: Rabbit Polyclonal Antibody for G beta 5 Antibody (GNB5) detection.tested for WB in Human, Mouse, Rat. |
|||
Anti-IL-3R beta Antibody |
|||
| A02219-1 | BosterBio | 100ul | EUR 397 |
|
Description: Rabbit Polyclonal Antibody for IL-3R beta Antibody (CSF2RB) detection.tested for WB in Human, Mouse, Rat. |
|||
Anti-beta glucuronidase/GUSB Antibody |
|||
| A02234-1 | BosterBio | 100ug/vial | EUR 294 |
Anti-PGC1 beta/PPARGC1B Antibody |
|||
| A02933-1 | BosterBio | 100ug/vial | EUR 294 |
Anti-Inhibin beta-C Antibody |
|||
| A10556-1 | BosterBio | 100ul | EUR 397 |
|
Description: Rabbit Polyclonal Antibody for Inhibin beta-C Antibody (INHBC) detection. Tested with WB in Human, Mouse, Rat. |
|||
PSG5 Human, Pregnancy Specific Beta-1-Glycoprotein 5 Human Recombinant Protein, Sf9 |
|||
| PROTQ15238-1 | BosterBio | Regular: 5ug | EUR 317 |
|
Description: PSG5 Human Recombinant produced in Sf9 Insect cells is a single, glycosylated polypeptide chain containing 310 amino acids (35-335 a.a.) and having a molecular mass of 35.1kDa (Molecular size on SDS-PAGE will appear at approximately 28-40kDa). PSG5 is expressed with a 6 amino acids His tag at C-Terminus and purified by proprietary chromatographic techniques. |
|||
HSP90B1 Heat Shock Protein 90kDa Beta (GRP94) Member 1 Human Recombinant Protein |
|||
| PROTP14625-1 | BosterBio | Regular: 10ug | EUR 317 |
|
Description: HSP90B1 produced in E.Coli is a single, non-glycosylated polypeptide chain containing 819 amino acids (22-803 a.a.) and having a molecular mass of 94.4 kDa.;HSP90B1 is expressed with a 36 amino acid His tag at N-Terminus and purified by proprietary chromatographic techniques. |
|||
ST6GAL1Human, ST6 Beta-Galactosamide Alpha-2,6-Sialyltranferase 1, sf9 Human Recombinant Protein |
|||
| PROTP15907-1 | BosterBio | Regular: 10ug | EUR 317 |
|
Description: ST6GAL1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 389 amino acids (27-406 a.a.) and having a molecular mass of 44.6kDa (Migrates at 40-57kDa on SDS-PAGE under reducing conditions). |
|||
B2M Beta-2 Microglobulin Human protein |
|||
| PROTP61769-1 | BosterBio | Regular: 1mg | EUR 317 |
|
Description: Human Beta-2 Microglobulin produced in Human urine from patients with tubular proteinuria having a molecular mass of 12KDa and pI of 5.6. |
|||
Recombinant Human Thymosin-Beta 4 Protein |
|||
| PROTP62328-1 | BosterBio | 100ug | EUR 317 |
|
Description: Thymosin-β4 is a small, actin-sequestering protein belonging to the thymosin-β family that is found at high concentrations within the spleen, thymus, and peritoneal macrophages, where it is most notably responsible for the organization of cytoskeletal structure. In mammalian tissues, this protein acts as a modulator for the polymerization/depolymerization of actin through the formation of a 1:1 complex with the monomer G (globular)-actin, and inhibits actin’s polymerization to form F (filamentous) actin, which together with other proteins binds microfilaments to construct the cytoskeleton. Commonly found at significant quantities within the brain, lungs, liver, kidneys, testes, and heart, Thymosin-β4 has also been shown to be synthesized by cells unrelated to the reticuloendothelial system, such as myoblasts and fibroblasts, and expressed at irregular levels by several hemopoietic cell lines, malignant lymphoid cells and myeloma cells. In addition to regulating actin polymerization, research has also found Thymosin-β4 to stimulate the secretion of hypothalamic luteinizing hormone-releasing hormone and luteinizing hormone, inhibit the migration of peritoneal macrophages, induce phenotypic changes in T cell lines during early host defense mechanisms, and inhibit the progression of hematopoietic pluripotent stem cells into the s-phase. Recombinant Human Thymosin-β4 is a 5.2 kDa glycoprotein containing 45 amino acid residues. |
|||
Anti-beta Catenin Rabbit Monoclonal Antibody |
|||
| M00004-1 | BosterBio | 100ug/vial | EUR 397 |
|
Description: Rabbit Monoclonal beta Catenin Antibody. Validated in IP, IF, IHC, ICC, WB and tested in Human, Mouse, Rat. |
|||
Anti-IL1 beta Rabbit Monoclonal Antibody |
|||
| M00101-1 | BosterBio | 100ug/vial | EUR 397 |
|
Description: Rabbit Monoclonal IL1 beta Antibody. Validated in WB and tested in Human. |
|||
Anti-IKK beta Rabbit Monoclonal Antibody |
|||
| M00118-1 | BosterBio | 100ug/vial | EUR 397 |
|
Description: Rabbit Monoclonal IKK beta Antibody. Validated in IP, WB and tested in Human, Mouse. |
|||
Anti-CEBP Beta Rabbit Monoclonal Antibody |
|||
| M01100-1 | BosterBio | 100ug/vial | EUR 397 |
|
Description: Rabbit Monoclonal CEBP Beta Antibody. Validated in IP, WB and tested in Human, Mouse, Rat. |
|||
Anti-Hsp90 beta Rabbit Monoclonal Antibody |
|||
| M01692-1 | BosterBio | 100ug/vial | EUR 397 |
|
Description: Rabbit Monoclonal Hsp90 beta Antibody. Validated in IP, IF, IHC, WB and tested in Human, Mouse, Rat. |
|||
Anti-FSH beta (FSHB) Monoclonal Antibody |
|||
| M01885-1 | BosterBio | 100ug | EUR 397 |
|
Description: Rabbit Monoclonal FSH beta (FSHB) Antibody. Validated in IP, WB and tested in Human. |
|||
LD78-beta (CCL3L1) Human Recombinant Protein |
|||
| PROTP16619-1 | BosterBio | Regular: 20ug | EUR 317 |
|
Description: CCL3L1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 70 amino acids and having a molecular mass of 7.7kDa. The CCL3L1 is purified by proprietary chromatographic techniques. |
|||
Anti-Integrin beta 4/ITGB4 Antibody |
|||
| PA1702-1 | BosterBio | 100ug/vial | EUR 294 |
Anti-PDGF Receptor beta/PDGFRB Antibody |
|||
| A00096-1 | BosterBio | 100ug/vial | EUR 334 |
Anti-Beta 2 Microglobulin/B2M Antibody |
|||
| A00456-1 | BosterBio | 100ug/vial | EUR 334 |
Anti-Estrogen Receptor beta/ESR2 Antibody |
|||
| A00786-1 | BosterBio | 100ug/vial | EUR 294 |
Anti-TGF beta 2/TGFB2 Antibody |
|||
| A00892-1 | BosterBio | 100ug/vial | EUR 334 |
Anti-Fibrinogen beta chain/FGB Antibody |
|||
| A01204-1 | BosterBio | 100ug/vial | EUR 294 |
Anti- beta II tubulin Monoclonal Antibody |
|||
| A06868-1 | BosterBio | 100ul | EUR 397 |
|
Description: Mouse Monoclonal Antibody for beta II tubulin Antibody (TUBB2A) detection.tested for IHC, IP, WB in Mouse, Rat. |
|||
DiscoveryProbe? TGF-beta/Smad Compound Library |
|||
| L1045-.1 | ApexBio | 100 uL/well(10 mM solution) | EUR 1639 |